Host taxon 9606
Protein NP_078985.3
uncharacterized protein C1orf115
Homo sapiens
Gene C1orf115, UniProt Q9H7X2
>NP_078985.3|Haemophilus ducreyi 35000HP|uncharacterized protein C1orf115
MTVGARLRSKAESSLLRRGPRGRGRTEGDEEAAAILEHLEYADEAEAAAESGTSAADERGPGTRGARRVHFALLPERYEPLEEPAPSEQPRKRYRRKLKKYGKNVGKVIIKGCRYVVIGLQGFAAAYSAPFAVATSVVSFVR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.72 | -0.717809444644543 | 0.008 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)