Host taxon 9606
Protein NP_001308328.1
uncharacterized protein C17orf78 isoform 2
Homo sapiens
Gene C17orf78, UniProt Q8N4C9
>NP_001308328.1|Haemophilus ducreyi 35000HP|uncharacterized protein C17orf78 isoform 2
MDTILVFSLIIASYDANKKDLRDSSCRLEQLPGIFPKDVRSIRELQMQETHTETKRTTFIQNRTIATLQCLGSDSKVKVNLVYLERRPKVKHILKNLRIIAAPRRNSSASSSCHLIPTSKFQTGSLLKGKVSMPRSQEAVPMPVVVEMAKEGRPATWDS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● -8.14 | -8.14067638732952 | 0.037 | 31213562 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)