Host taxon 9606
Protein NP_001137408.1
uncharacterized protein C15orf61 precursor
Homo sapiens
Gene C15orf61, UniProt A6NNL5
>NP_001137408.1|Haemophilus ducreyi 35000HP|uncharacterized protein C15orf61 precursor
MEALRRAHEVALRLLLCRPWASRAAARPKPSASEVLTRHLLQRRLPHWTSFCVPYSAVRNDQFGLSHFNWPVQGANYHVLRTGCFPFIKYHCSKAPWQDLARQNRFFTALKVVNLGIPTLLYGLGSWLFARVTETVHTSYGPITVYFLNKEDEGAMY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.86 | -0.857186725407867 | 1.5e-5 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)