Host taxon 9606
Protein NP_001287842.1
uncharacterized protein C11orf24 isoform 2 precursor
Homo sapiens
Gene C11orf24, UniProt Q96F05
>NP_001287842.1|Haemophilus ducreyi 35000HP|uncharacterized protein C11orf24 isoform 2 precursor
MWTALVLIWIFSLSLSESHAASNDPRNFVPNKMWKGLVKRNASVETVDNKTSEDVTMAAASPVTLTKGTSAAHLNSMEVTTEDTSRTDAYESYKKKDYTQVDYLINGMYADSEM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.11 | 1.10663246845452 | 1.2e-6 | 31213562 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)