Host taxon 9606
Protein NP_001258613.1
UDP-N-acetylglucosamine transporter isoform 2
Homo sapiens
Gene SLC35A3, UniProt Q9Y2D2
>NP_001258613.1|Haemophilus ducreyi 35000HP|UDP-N-acetylglucosamine transporter isoform 2
MFANLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLVSFSLEPSL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.39 | -0.386451766729489 | 0.0077 | 31213562 | |
Retrieved 1 of 4 entries in 1.7 ms
(Link to these results)