Host taxon 9606
Protein NP_001041706.1
ubiquitin-like protein 5
Homo sapiens
Gene UBL5, UniProt Q9BZL1
>NP_001041706.1|Haemophilus ducreyi 35000HP|ubiquitin-like protein 5
MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2 | 2.00185609139717 | 5.8e-6 | 31213562 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)