Host taxon 9606
Protein NP_057490.2
ubiquitin-fold modifier-conjugating enzyme 1
Homo sapiens
Gene UFC1, UniProt Q9Y3C8
>NP_057490.2|Haemophilus ducreyi 35000HP|ubiquitin-fold modifier-conjugating enzyme 1
MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.89 | 0.890142156389226 | 0.0035 | 31213562 | |
Retrieved 1 of 1 entries in 11 ms
(Link to these results)