Host taxon 9606
Protein NP_001138633.1
ubiquitin-conjugating enzyme E2Q-like protein 1
Homo sapiens
Gene UBE2QL1, UniProt A1L167
>NP_001138633.1|Haemophilus ducreyi 35000HP|ubiquitin-conjugating enzyme E2Q-like protein 1
MKELQDIARLSDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPDNFPFSPPFMRVLSPRLENGYVLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGRICRKAGKSKKSFSRKEAEATFKSLVKTHEKYGWVTPPVSDG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.38 | -1.37708491594187 | 0.0033 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)