Host taxon 9606
Protein NP_055316.2
ubiquitin-conjugating enzyme E2 S
Homo sapiens
Gene UBE2S, UniProt Q16763
>NP_055316.2|Haemophilus ducreyi 35000HP|ubiquitin-conjugating enzyme E2 S
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.51 | 1.51328440154555 | 2.8e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)