Host taxon 9606
Protein NP_001243284.1
ubiquitin-conjugating enzyme E2 L3 isoform 4
Homo sapiens
Gene UBE2L3, UniProt P68036
>NP_001243284.1|Haemophilus ducreyi 35000HP|ubiquitin-conjugating enzyme E2 L3 isoform 4
MQVAAGTRGDTRLQEVALLPQLFDLLVLGQRRARLLRQVPSALAGKDLAQLQAGATLAGYRRAHGPEELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.89 | 0.894755066006045 | 0.0037 | 31213562 | |
Retrieved 1 of 2 entries in 10.9 ms
(Link to these results)