Host taxon 9606
Protein NP_689866.1
ubiquitin-conjugating enzyme E2 E2 isoform 1
Homo sapiens
Gene UBE2E2, UniProt Q96LR5
>NP_689866.1|Haemophilus ducreyi 35000HP|ubiquitin-conjugating enzyme E2 E2 isoform 1
MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.54 | 0.544705974282674 | 0.0012 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)