Host taxon 9606
Protein NP_001189405.1
ubiquitin-conjugating enzyme E2 E1 isoform 3
Homo sapiens
Gene UBE2E1, UniProt P51965
>NP_001189405.1|Haemophilus ducreyi 35000HP|ubiquitin-conjugating enzyme E2 E1 isoform 3
MKEVGRPREVRGRPGKSRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.62 | 0.620337643938989 | 5.9e-5 | 31213562 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)