Host taxon 9606
Protein NP_003331.1
ubiquitin-conjugating enzyme E2 D3 isoform 1
Homo sapiens
Gene UBE2D3, UniProt P61077
>NP_003331.1|Haemophilus ducreyi 35000HP|ubiquitin-conjugating enzyme E2 D3 isoform 1
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.85 | 0.845455909622822 | 0.00013 | 31213562 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)