Host taxon 9606
Protein NP_003329.1
ubiquitin-conjugating enzyme E2 D1 isoform 1
Homo sapiens
Gene UBE2D1, UniProt P51668
>NP_003329.1|Haemophilus ducreyi 35000HP|ubiquitin-conjugating enzyme E2 D1 isoform 1
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.59 | 1.5926120736032 | 4.1e-8 | 31213562 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)