Host taxon 9606
Protein NP_001268670.1
ubiquitin-conjugating enzyme E2 C isoform 6
Homo sapiens
Gene UBE2C, UniProt O00762
>NP_001268670.1|Haemophilus ducreyi 35000HP|ubiquitin-conjugating enzyme E2 C isoform 6
MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQMPEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.42 | 2.41734399449926 | 1.4e-13 | 31213562 | |
Retrieved 1 of 4 entries in 1.9 ms
(Link to these results)