Host taxon 9606
Protein NP_001269090.1
ubiquitin-conjugating enzyme E2 A isoform 4
Homo sapiens
Gene UBE2A, UniProt P49459
>NP_001269090.1|Haemophilus ducreyi 35000HP|ubiquitin-conjugating enzyme E2 A isoform 4
MVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWRDC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.88 | 0.883810880745516 | 0.00028 | 31213562 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)