Host taxon 9606
Protein NP_001029102.1
ubiquitin-60S ribosomal protein L40 isoform 1 precursor
Homo sapiens
Gene UBA52, UniProt P62987
>NP_001029102.1|Haemophilus ducreyi 35000HP|ubiquitin-60S ribosomal protein L40 isoform 1 precursor
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.22 | 1.2154354090636 | 3.8e-5 | 31213562 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)