Host taxon 9606
Protein NP_116270.1
U7 snRNA-associated Sm-like protein LSm10
Homo sapiens
Gene LSM10, UniProt Q969L4
>NP_116270.1|Haemophilus ducreyi 35000HP|U7 snRNA-associated Sm-like protein LSm10
MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.31 | 1.30725402106913 | 0.00014 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)