Host taxon 9606
Protein NP_057283.1
U6 snRNA-associated Sm-like protein LSm7
Homo sapiens
Gene LSM7, UniProt Q9UK45
>NP_057283.1|Haemophilus ducreyi 35000HP|U6 snRNA-associated Sm-like protein LSm7
MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.66 | 1.65699544135569 | 8.1e-7 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)