Host taxon 9606
Protein NP_001182231.1
U6 snRNA phosphodiesterase isoform 2
Homo sapiens
Gene USB1, UniProt Q9BQ65
>NP_001182231.1|Haemophilus ducreyi 35000HP|U6 snRNA phosphodiesterase isoform 2
MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQALKARMTSFHRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGFEDAEVLLRVHTEQVRCKSGNKFFSMPLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.93 | 1.93218893069133 | 2.9e-9 | 31213562 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)