Host taxon 9606
Protein NP_060755.1
U3 small nucleolar ribonucleoprotein protein IMP3
Homo sapiens
Gene IMP3, UniProt Q9NV31
>NP_060755.1|Haemophilus ducreyi 35000HP|U3 small nucleolar ribonucleoprotein protein IMP3
MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.58 | 0.576751359275503 | 0.0029 | 31213562 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)