Host taxon 9606
Protein NP_001003395.1
tumor protein D53 isoform 2
Homo sapiens
Gene TPD52L1, UniProt Q16890
>NP_001003395.1|Haemophilus ducreyi 35000HP|tumor protein D53 isoform 2
MLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.02 | -1.01823488880012 | 0.01 | 31213562 | |
Retrieved 1 of 4 entries in 0.8 ms
(Link to these results)