Host taxon 9606
Protein NP_003832.3
tumor necrosis factor receptor superfamily member 10C precursor
Homo sapiens
Gene TNFRSF10C, UniProt O14798
>NP_003832.3|Haemophilus ducreyi 35000HP|tumor necrosis factor receptor superfamily member 10C precursor
MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTPASSHYLSCTIVGIIVLIVLLIVFV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.05 | 5.04796268939834 | 6.0e-13 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)