Host taxon 9606
Protein NP_001235.1
tumor necrosis factor ligand superfamily member 8 isoform 1
Homo sapiens
Gene TNFSF8, UniProt P32971
>NP_001235.1|Haemophilus ducreyi 35000HP|tumor necrosis factor ligand superfamily member 8 isoform 1
MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.07 | 2.06540084482182 | 2.5e-9 | 31213562 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)