Host taxon 9606
Protein NP_001191273.1
tumor necrosis factor ligand superfamily member 15 isoform VEGI-192
Homo sapiens
Gene TNFSF15, UniProt O95150
>NP_001191273.1|Haemophilus ducreyi 35000HP|tumor necrosis factor ligand superfamily member 15 isoform VEGI-192
MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.57 | 1.56771942608246 | 0.0047 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)