Host taxon 9606
Protein NP_003800.1
tumor necrosis factor ligand superfamily member 12 proprotein
Homo sapiens
Gene TNFSF12, UniProt O43508
>NP_003800.1|Haemophilus ducreyi 35000HP|tumor necrosis factor ligand superfamily member 12 proprotein
MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.85 | 0.846329768981725 | 0.0054 | 31213562 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)