Host taxon 9606
Protein NP_078851.2
tumor necrosis factor alpha-induced protein 8-like protein 2
Homo sapiens
Gene TNFAIP8L2, UniProt Q6P589
>NP_078851.2|Haemophilus ducreyi 35000HP|tumor necrosis factor alpha-induced protein 8-like protein 2
MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.48 | 2.48033180685846 | 1.5e-9 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)