Host taxon 9606
Protein NP_001161414.1
tumor necrosis factor alpha-induced protein 8-like protein 1
Homo sapiens
Gene TNFAIP8L1, UniProt Q8WVP5
>NP_001161414.1|Haemophilus ducreyi 35000HP|tumor necrosis factor alpha-induced protein 8-like protein 1
MDTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.71 | 0.709661384223207 | 0.00068 | 31213562 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)