Host taxon 9606
Protein NP_001071122.1
tumor necrosis factor alpha-induced protein 8 isoform b
Homo sapiens
Gene TNFAIP8, UniProt O95379
>NP_001071122.1|Haemophilus ducreyi 35000HP|tumor necrosis factor alpha-induced protein 8 isoform b
MATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.79 | 1.7939278200722 | 2.5e-7 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)