Host taxon 9606
Protein NP_001284667.1
tubulin-specific chaperone A isoform 1
Homo sapiens
Gene TBCA, UniProt O75347
>NP_001284667.1|Haemophilus ducreyi 35000HP|tubulin-specific chaperone A isoform 1
MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILVSKDFCVMFKFFFSIQYMESQKFKYLTLRTSWQYFLFTCPLYRYILK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.29 | 1.28524412725688 | 2.6e-5 | 31213562 | |
Retrieved 1 of 3 entries in 1.3 ms
(Link to these results)