Host taxon 9606
Protein NP_008961.1
tubulin polymerization-promoting protein
Homo sapiens
Gene TPPP, UniProt O94811
>NP_008961.1|Haemophilus ducreyi 35000HP|tubulin polymerization-promoting protein
MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.98 | -1.97570335426117 | 8.6e-9 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)