Host taxon 9606
Protein NP_003270.1
troponin C, skeletal muscle
Homo sapiens
Gene TNNC2, UniProt P02585
>NP_003270.1|Haemophilus ducreyi 35000HP|troponin C, skeletal muscle
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.45 | -1.45222366987051 | 0.002 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)