Host taxon 9606
Protein NP_005414.1
trefoil factor 2 precursor
Homo sapiens
Gene TFF2, UniProt Q03403
>NP_005414.1|Haemophilus ducreyi 35000HP|trefoil factor 2 precursor
MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● -4.35 | -4.3491978834604 | 0.028 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)