Host taxon 9606
Protein NP_001287763.1
transmembrane protein C1orf162 isoform 2
Homo sapiens
Gene C1orf162, UniProt Q8NEQ5
>NP_001287763.1|Haemophilus ducreyi 35000HP|transmembrane protein C1orf162 isoform 2
MGGNGSTCKPDTERQGTLSTAAPTTSPAPCLSNHHNKKHLILAFCAGVLLTLLLIAFIFLIIKSYRKYHSKPQAPDPHSDPPAKLSSIPGESLTYASTTFKLSEEKSNHLAENHSADFDPIVYAQIKVTN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.04 | 2.03859577289125 | 1.1e-9 | 31213562 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)