Host taxon 9606
Protein NP_001273023.1
transmembrane protein 9B isoform b
Homo sapiens
Gene TMEM9B, UniProt Q9NQ34
>NP_001273023.1|Haemophilus ducreyi 35000HP|transmembrane protein 9B isoform b
MPVRGPDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.44 | 0.438900144448864 | 0.015 | 31213562 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)