Host taxon 9606
Protein NP_981956.1
transmembrane protein 88 isoform 1
Homo sapiens
Gene TMEM88, UniProt Q6PEY1
>NP_981956.1|Haemophilus ducreyi 35000HP|transmembrane protein 88 isoform 1
MADVPGAQRAVPGDGPEPRDPLDCWACAVLVTAQNLLVAAFNLLLLVLVLGTILLPAVTMLGFGFLCHSQFLRSQAPPCTAHLRDPGFTALLVTGFLLLVPLLVLALASYRRLCLRLRLADCLVPYSRALYRRRRAPQPRQIRASPGSQAVPTSGKVWV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.73 | 1.72681420553837 | 5.9e-8 | 31213562 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)