Host taxon 9606
Protein NP_001257296.1
transmembrane protein 254 isoform 2
Homo sapiens
Gene TMEM254, UniProt Q8TBM7
>NP_001257296.1|Haemophilus ducreyi 35000HP|transmembrane protein 254 isoform 2
MGAGTAGELPANSVSGFFKRMVKSEASNAATAYFRPARPLPSLVTVLGLGYFAWVVFWPQSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKHKGITSGRAQLLWFLQTFFFGIASLTILIAYKRKRQKQT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.16 | -1.16336832737999 | 0.0017 | 31213562 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)