Host taxon 9606
Protein NP_001004313.1
transmembrane protein 220 isoform 1 precursor
Homo sapiens
Gene TMEM220, UniProt Q6QAJ8
>NP_001004313.1|Haemophilus ducreyi 35000HP|transmembrane protein 220 isoform 1 precursor
MAPALWRACNGLMAAFFALAALVQVNDPDAEVWVVVYTIPAVLTLLVGLNPEVTGNVIWKSISAIHILFCTVWAVGLASYLLHRTQQNILHEEEGRELSGLVIITAWIILCHSSSKNPVGGRIQLAIAIVITLFPFISWVYIYINKEMRSSWPTHCKTVI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.6 | -0.602808445862477 | 0.00058 | 31213562 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)