Host taxon 9606
Protein NP_631911.1
transmembrane protein 190 precursor
Homo sapiens
Gene TMEM190, UniProt Q8WZ59
>NP_631911.1|Haemophilus ducreyi 35000HP|transmembrane protein 190 precursor
MLGCGIPALGLLLLLQGSADGNGIQGFFYPWSCEGDIWDRESCGGQAAIDSPNLCLRLRCCYRNGVCYHQRPDENVRRKHMWALVWTCSGLLLLSCSICLFWWAKRRDVLHMPGFLAGPCDMSKSVSLLSKHRGTKKTPSTGSVPVALSKESRDVEGGTEGEGTEEGEETEGEEEED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.4 | -1.39668446876945 | 0.00084 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)