Host taxon 9606
Protein NP_060324.1
transmembrane protein 160 precursor
Homo sapiens
Gene TMEM160, UniProt Q9NX00
>NP_060324.1|Haemophilus ducreyi 35000HP|transmembrane protein 160 precursor
MGGGWWWARAARLARLRFRRSLLPPQRPRSGGARGSFAPGHGPRAGASPPPVSELDRADAWLLRKAHETAFLSWFRNGLLASGIGVISFMQSDMGREAAYGFFLLGGLCVVWGSASYAVGLAALRGPMQLTLGGAAVGAGAVLAASLLWACAVGLYMGQLELDVELVPEDDGTASAEGPDEAGRPPPE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.71 | 0.70663965073407 | 0.011 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)