Host taxon 9606
Protein NP_001231664.1
transmembrane protein 126A isoform 2
Homo sapiens
Gene TMEM126A, UniProt Q9H061
>NP_001231664.1|Haemophilus ducreyi 35000HP|transmembrane protein 126A isoform 2
MAGIPFLTTDLTYRCFVSFPLNTGDLDCETCTITRSGLTGLVIGGLYPVFLAIPVNGGLAARYQSALLPHKGNILSYWIRTSKPVFRKMLFPILLQTMFSAYLGSEQYKLLIKALQLSEPGKEIH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.57 | 0.571883505535218 | 0.013 | 31213562 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)