Host taxon 9606
Protein NP_001138779.1
leucine-rich repeat-containing protein 51 isoform LRTOMT1b
Homo sapiens
Gene LRTOMT, UniProt Q96E66
>NP_001138779.1|Haemophilus ducreyi 35000HP|leucine-rich repeat-containing protein 51 isoform LRTOMT1b
MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPMEEEKGYRVPGSVEMPHRPP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.58 | -0.58414880252012 | 0.0086 | 31213562 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)