Host taxon 9606
Protein NP_671729.2
transmembrane inner ear expressed protein isoform 1 precursor
Homo sapiens
Gene TMIE, UniProt Q8NEW7
>NP_671729.2|Haemophilus ducreyi 35000HP|transmembrane inner ear expressed protein isoform 1 precursor
MAGWPGAGPLCVLGGAALGVCLAGVAGQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVVGIFSLFVLSIIITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKKDSVDTVAIKVEEDEKNEAKKKKGEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.11 | -1.10730503101515 | 0.0021 | 31213562 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)