Host taxon 9606
Protein NP_001162597.1
transmembrane and immunoglobulin domain-containing protein 2 isoform 2 precursor
Homo sapiens
Gene TMIGD2, UniProt Q96BF3
>NP_001162597.1|Haemophilus ducreyi 35000HP|transmembrane and immunoglobulin domain-containing protein 2 isoform 2 precursor
MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNAFYSNVLYRPRGAPKKSEDCSGEGKDQRGQSIYSTSFPQPAPRQPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVGEE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.67 | 2.67447365218224 | 0.0011 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)