Host taxon 9606
Protein NP_057017.1
translation machinery-associated protein 7 isoform 1
Homo sapiens
Gene TMA7, UniProt Q9Y2S6
>NP_057017.1|Haemophilus ducreyi 35000HP|translation machinery-associated protein 7 isoform 1
MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.31 | 1.31438907824291 | 1.1e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)