Host taxon 9606
Protein NP_001230808.1
transformer-2 protein homolog beta isoform 2
Homo sapiens
Gene TRA2B, UniProt P62995
>NP_001230808.1|Haemophilus ducreyi 35000HP|transformer-2 protein homolog beta isoform 2
MSTRRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGYDDRDYYSRSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSPRRY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.66 | 0.663972833737414 | 0.0011 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)