Host taxon 9606
Protein NP_005636.1
transcription initiation factor TFIID subunit 13
Homo sapiens
Gene TAF13, UniProt Q15543
>NP_005636.1|Haemophilus ducreyi 35000HP|transcription initiation factor TFIID subunit 13
MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.81 | 0.810544391371815 | 2.4e-5 | 31213562 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)