Host taxon 9606
Protein NP_006275.1
transcription initiation factor TFIID subunit 10
Homo sapiens
Gene TAF10, UniProt Q12962
>NP_006275.1|Haemophilus ducreyi 35000HP|transcription initiation factor TFIID subunit 10
MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.58 | 0.583969225817454 | 0.00035 | 31213562 | |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)