Host taxon 9606
Protein NP_001307858.1
transcription initiation factor IIA subunit 2
Homo sapiens
Gene GTF2A2, UniProt P52657
>NP_001307858.1|Haemophilus ducreyi 35000HP|transcription initiation factor IIA subunit 2
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.9 | 0.899866922438397 | 7.7e-5 | 31213562 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)