Host taxon 9606
Protein NP_001006685.1
transcription elongation factor A protein-like 8
Homo sapiens
Gene TCEAL8, UniProt Q8IYN2
>NP_001006685.1|Haemophilus ducreyi 35000HP|transcription elongation factor A protein-like 8
MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.57 | 0.566897409241135 | 0.00092 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)